PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa013867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 323aa    MW: 36877.4 Da    PI: 5.8781
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58680642PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1956111156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++ +++t++q++e+e++F+++++p+ ++r+eL ++l+L+  qVk+WFqN+R+++k
  Lsa013867  56 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELGRRLSLEPLQVKFWFQNKRTQMK 111
                688999***********************************************998 PP

2START38.62.8e-13246322168
                HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCC CS
      START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveelldd 68 
                ela +a++elv++a++ ep+Wv  s    e++ +de+l++f+++ +      ++ea+r+s vv+m++++lve+l+d+
  Lsa013867 246 ELAVTAMEELVRMAQVCEPLWVPTSnnshEILSEDEYLRSFPRGIGpklmgWKSEASRESMVVIMNHMTLVEILMDV 322
                57899*******************99*****************999*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2236111IPR009057Homeodomain-like
SuperFamilySSF466894.6E-1940113IPR009057Homeodomain-like
PROSITE profilePS5007116.35853113IPR001356Homeobox domain
SMARTSM003891.4E-1654117IPR001356Homeobox domain
CDDcd000865.57E-1756114No hitNo description
PfamPF000462.6E-1756111IPR001356Homeobox domain
PROSITE profilePS5084813.332237323IPR002913START domain
PfamPF018528.3E-8247322IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MFENHHHHHL LDMSHRAPEN NLVMLRDDDQ DSKSGNDIME AVSGDDQDPS QHANKKKRYH  60
RHTQHQIQEM EAFFKECPHP DDKQRKELGR RLSLEPLQVK FWFQNKRTQM KAQHERFDNT  120
QLRNENEKLQ AENIRYKEAL ANATCPNCGG PAAIGEMSFD EQQLRMENAR LREEIDRISG  180
IAAKYVGKPM VSYPDASSQG PSRSLDLPVA SFSPQQGMVG EMFGANDLLR SLAGGPTEAE  240
KPIIIELAVT AMEELVRMAQ VCEPLWVPTS NNSHEILSED EYLRSFPRGI GPKLMGWKSE  300
ASRESMVVIM NHMTLVEILM DVX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086174.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V991e-149PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A118K0F50.0A0A118K0F5_CYNCS; Homeodomain-containing protein
STRINGVIT_10s0116g00680.t011e-172(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-147protodermal factor 2